Lineage for d1jc5b_ (1jc5 B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) 
Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein) Protein Methylmalonyl-CoA epimerase [64258] (1 species) Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries) 
Domain d1jc5b_: 1jc5 B: [62868]
Details for d1jc5b_
PDB Entry: 1jc5 (more details), 2.2 Å
PDB Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase
SCOP Domain Sequences for d1jc5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jc5b_ d.32.1.4 (B:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
gtggnrinfmhpksgkgvlieltqypk
SCOP Domain Coordinates for d1jc5b_:
Click to download the PDB-style file with coordinates for d1jc5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jc5b_:
- d1jc5b_ is new in SCOP 1.57
- d1jc5b_ appears in SCOP 1.59
- d1jc5b_ appears in the current release, SCOPe 2.08
View in 3D
