Lineage for d1jc5a_ (1jc5 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79199Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 79200Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 79282Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
  6. 79283Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 79284Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 79289Domain d1jc5a_: 1jc5 A: [62867]

Details for d1jc5a_

PDB Entry: 1jc5 (more details), 2.2 Å

PDB Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase

SCOP Domain Sequences for d1jc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc5a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
ggnrinfmhpksgkgvlieltqypk

SCOP Domain Coordinates for d1jc5a_:

Click to download the PDB-style file with coordinates for d1jc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jc5a_: