Lineage for d1jc4c_ (1jc4 C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720941Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 720942Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) (S)
  5. 721178Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
    Different association of repeats but a similar dimeric structure to the glyoxalase dimer
  6. 721179Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 721180Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 721183Domain d1jc4c_: 1jc4 C: [62865]

Details for d1jc4c_

PDB Entry: 1jc4 (more details), 2 Å

PDB Description: crystal structure of se-met methylmalonyl-coa epimerase
PDB Compounds: (C:) Methylmalonyl-CoA Epimerase

SCOP Domain Sequences for d1jc4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc4c_ d.32.1.4 (C:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]}
nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
ggnrinfmhpksgkgvlieltqypk

SCOP Domain Coordinates for d1jc4c_:

Click to download the PDB-style file with coordinates for d1jc4c_.
(The format of our PDB-style files is described here.)

Timeline for d1jc4c_: