Lineage for d1jc4c_ (1jc4 C:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132421Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 132422Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 132512Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
  6. 132513Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 132514Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 132517Domain d1jc4c_: 1jc4 C: [62865]

Details for d1jc4c_

PDB Entry: 1jc4 (more details), 2 Å

PDB Description: crystal structure of se-met methylmalonyl-coa epimerase

SCOP Domain Sequences for d1jc4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc4c_ d.32.1.4 (C:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
ggnrinfmhpksgkgvlieltqypk

SCOP Domain Coordinates for d1jc4c_:

Click to download the PDB-style file with coordinates for d1jc4c_.
(The format of our PDB-style files is described here.)

Timeline for d1jc4c_: