SCOP 1.57: Domain d1jc4b_: 1jc4 B:

Lineage for d1jc4b_ (1jc4 B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families)

5. Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)

6. Protein Methylmalonyl-CoA epimerase [64258] (1 species)

7. Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)

8. Domain d1jc4b_: 1jc4 B: [62864]

Details for d1jc4b_

PDB Entry: 1jc4, 2 Å

PDB Description: crystal structure of se-met methylmalonyl-coa epimerase

SCOP Domain Sequences for d1jc4b_:

Sequence; same for both SEQRES and ATOM records:

>d1jc4b_ d.32.1.4 (B:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
gnrinfmhpksgkgvlieltqypk

Timeline for d1jc4b_:

• d1jc4b_ is new in SCOP 1.57
  
• d1jc4b_ appears in SCOP 1.59
  
• d1jc4b_ appears in the current release, SCOPe 2.08