Lineage for d1jc4b_ (1jc4 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942821Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
    Different association of repeats but a similar dimeric structure to the glyoxalase dimer
    automatically mapped to Pfam PF13669
  6. 2942822Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 2942823Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 2942831Domain d1jc4b_: 1jc4 B: [62864]
    complexed with so4

Details for d1jc4b_

PDB Entry: 1jc4 (more details), 2 Å

PDB Description: crystal structure of se-met methylmalonyl-coa epimerase
PDB Compounds: (B:) Methylmalonyl-CoA Epimerase

SCOPe Domain Sequences for d1jc4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc4b_ d.32.1.4 (B:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]}
edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
gnrinfmhpksgkgvlieltqypk

SCOPe Domain Coordinates for d1jc4b_:

Click to download the PDB-style file with coordinates for d1jc4b_.
(The format of our PDB-style files is described here.)

Timeline for d1jc4b_: