Lineage for d1jc4a_ (1jc4 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255972Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 255973Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 256093Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
    Different assosiation of repeats but a similar dimeric structure to the glyoxalase dimer
  6. 256094Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 256095Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 256096Domain d1jc4a_: 1jc4 A: [62863]

Details for d1jc4a_

PDB Entry: 1jc4 (more details), 2 Å

PDB Description: crystal structure of se-met methylmalonyl-coa epimerase

SCOP Domain Sequences for d1jc4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
ggnrinfmhpksgkgvlieltqypk

SCOP Domain Coordinates for d1jc4a_:

Click to download the PDB-style file with coordinates for d1jc4a_.
(The format of our PDB-style files is described here.)

Timeline for d1jc4a_: