Lineage for d1jbwa2 (1jbw A:1-296)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.72: Ribokinase-like [53612] (2 superfamilies) 
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) 
Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein) Protein Folylpolyglutamate synthetase [53630] (1 species) Species Lactobacillus casei [TaxId:1582] [53631] (3 PDB entries) 
Domain d1jbwa2: 1jbw A:1-296 [62861]
Other proteins in same PDB: d1jbwa1
Details for d1jbwa2
PDB Entry: 1jbw (more details), 1.85 Å
PDB Description: fpgs-amppcp-folate complex
SCOP Domain Sequences for d1jbwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbwa2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei}
mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
fefitalaywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash
SCOP Domain Coordinates for d1jbwa2:
Click to download the PDB-style file with coordinates for d1jbwa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jbwa2:
- d1jbwa2 is new in SCOP 1.57
- d1jbwa2 appears in SCOP 1.59
- d1jbwa2 appears in the current release, SCOPe 2.08
View in 3D
