| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) ![]() |
| Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein) |
| Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species) |
| Species Lactobacillus casei [TaxId:1582] [53252] (3 PDB entries) |
| Domain d1jbwa1: 1jbw A:297-425 [62860] Other proteins in same PDB: d1jbwa2 |
PDB Entry: 1jbw (more details), 1.85 Å
SCOP Domain Sequences for d1jbwa1:
Sequence, based on SEQRES records: (download)
>d1jbwa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg
>d1jbwa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtrlkdswqealaaslndvpdqpivitgslylasavrqtllg
Timeline for d1jbwa1: