Lineage for d1jbva2 (1jbv A:1-296)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2138018Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein)
  6. 2138019Protein Folylpolyglutamate synthetase [53630] (2 species)
  7. 2138020Species Lactobacillus casei [TaxId:1582] [53631] (7 PDB entries)
  8. 2138024Domain d1jbva2: 1jbv A:1-296 [62859]
    Other proteins in same PDB: d1jbva1
    complexed with acp, mg

Details for d1jbva2

PDB Entry: 1jbv (more details), 1.95 Å

PDB Description: fpgs-amppcp complex
PDB Compounds: (A:) Folylpolyglutamate synthase

SCOPe Domain Sequences for d1jbva2:

Sequence, based on SEQRES records: (download)

>d1jbva2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}
mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
fefitalaywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash

Sequence, based on observed residues (ATOM records): (download)

>d1jbva2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}
mnytetvayihsfpgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahvleasg
ltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvtefefit
alaywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtitaiakhk
agiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrftyedq
dgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash

SCOPe Domain Coordinates for d1jbva2:

Click to download the PDB-style file with coordinates for d1jbva2.
(The format of our PDB-style files is described here.)

Timeline for d1jbva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jbva1