Lineage for d1jbva1 (1jbv A:297-425)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703774Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 703775Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 703808Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)
  6. 703809Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)
  7. 703810Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries)
  8. 703814Domain d1jbva1: 1jbv A:297-425 [62858]
    Other proteins in same PDB: d1jbva2
    complexed with acp, mg

Details for d1jbva1

PDB Entry: 1jbv (more details), 1.95 Å

PDB Description: fpgs-amppcp complex
PDB Compounds: (A:) Folylpolyglutamate synthase

SCOP Domain Sequences for d1jbva1:

Sequence, based on SEQRES records: (download)

>d1jbva1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg

Sequence, based on observed residues (ATOM records): (download)

>d1jbva1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagamadrltaafstvyl
vpvpgtpralpearlkdswqealaaslndvpdqpivitgslylasavrqtllg

SCOP Domain Coordinates for d1jbva1:

Click to download the PDB-style file with coordinates for d1jbva1.
(The format of our PDB-style files is described here.)

Timeline for d1jbva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jbva2