![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
![]() | Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) ![]() |
![]() | Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein) |
![]() | Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species) |
![]() | Species Lactobacillus casei [TaxId:1582] [53252] (3 PDB entries) |
![]() | Domain d1jbva1: 1jbv A:297-425 [62858] Other proteins in same PDB: d1jbva2 complexed with acp, mg |
PDB Entry: 1jbv (more details), 1.95 Å
SCOP Domain Sequences for d1jbva1:
Sequence, based on SEQRES records: (download)
>d1jbva1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei} wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla savrqtllg
>d1jbva1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei} wparlekisdtplividgahnpdginglitalkqlfsqpitviagamadrltaafstvyl vpvpgtpralpearlkdswqealaaslndvpdqpivitgslylasavrqtllg
Timeline for d1jbva1: