Lineage for d1jbqf_ (1jbq F:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74602Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 74603Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 74604Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 protein domains)
  6. 74614Protein Cystathionine beta-synthase [64174] (1 species)
  7. 74615Species Human (Homo sapiens) [TaxId:9606] [64175] (1 PDB entry)
  8. 74621Domain d1jbqf_: 1jbq F: [62855]

Details for d1jbqf_

PDB Entry: 1jbq (more details), 2.6 Å

PDB Description: structure of human cystathionine beta-synthase: a unique pyridoxal 5'-phosphate dependent hemeprotein

SCOP Domain Sequences for d1jbqf_:

Sequence, based on SEQRES records: (download)

>d1jbqf_ c.79.1.1 (F:) Cystathionine beta-synthase {Human (Homo sapiens)}
wirpdapsrctwqlgrpasesphhhtapakspkilpdilkkigdtpmvrinkigkkfglk
cellakceffnaggsvkdrislrmiedaerdgtlkpgdtiieptsgntgiglalaaavrg
yrciivmpekmssekvdvlralgaeivrtptnarfdspeshvgvawrlkneipnshildq
yrnasnplahydttadeilqqcdgkldmlvasvgtggtitgiarklkekcpgcriigvdp
egsilaepeelnqteqttyevegigydfiptvldrtvvdkwfksndeeaftfarmliaqe
gllcggsagstvavavkaaqelqegqrcvvilpdsvrnymtkflsdrwmlqkgfl

Sequence, based on observed residues (ATOM records): (download)

>d1jbqf_ c.79.1.1 (F:) Cystathionine beta-synthase {Human (Homo sapiens)}
wirpdapsrctwqlgrpasesphhhtapakspkilpdilkkigdtpmvrinkigkkfglk
cellakceffnaggsvkdrislrmiedaerdgtlkpgdtiieptsgntgiglalaaavrg
yrciivmpekmssekvdvlralgaeivrtpteshvgvawrlkneipnshildqyrnasnp
lahydttadeilqqcdgkldmlvasvgtggtitgiarklkekcpgcriigvdpegsilae
peelnqteqttyevegigydfiptvldrtvvdkwfksndeeaftfarmliaqegllcggs
agstvavavkaaqelqegqrcvvilpdsvrnymtkflsdrwmlqkgfl

SCOP Domain Coordinates for d1jbqf_:

Click to download the PDB-style file with coordinates for d1jbqf_.
(The format of our PDB-style files is described here.)

Timeline for d1jbqf_: