Lineage for d1jbqd_ (1jbq D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139843Protein Cystathionine beta-synthase [64174] (1 species)
    PLP-dependent hemoprotein
  7. 2139844Species Human (Homo sapiens) [TaxId:9606] [64175] (3 PDB entries)
  8. 2139848Domain d1jbqd_: 1jbq D: [62853]
    complexed with hem, plp

Details for d1jbqd_

PDB Entry: 1jbq (more details), 2.6 Å

PDB Description: structure of human cystathionine beta-synthase: a unique pyridoxal 5'-phosphate dependent hemeprotein
PDB Compounds: (D:) cystathionine beta-synthase

SCOPe Domain Sequences for d1jbqd_:

Sequence, based on SEQRES records: (download)

>d1jbqd_ c.79.1.1 (D:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]}
wirpdapsrctwqlgrpasesphhhtapakspkilpdilkkigdtpmvrinkigkkfglk
cellakceffnaggsvkdrislrmiedaerdgtlkpgdtiieptsgntgiglalaaavrg
yrciivmpekmssekvdvlralgaeivrtptnarfdspeshvgvawrlkneipnshildq
yrnasnplahydttadeilqqcdgkldmlvasvgtggtitgiarklkekcpgcriigvdp
egsilaepeelnqteqttyevegigydfiptvldrtvvdkwfksndeeaftfarmliaqe
gllcggsagstvavavkaaqelqegqrcvvilpdsvrnymtkflsdrwmlqkgfl

Sequence, based on observed residues (ATOM records): (download)

>d1jbqd_ c.79.1.1 (D:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]}
wirpdapsrctwqlgrpasesphhhtapakspkilpdilkkigdtpmvrinkigkkfglk
cellakceffnaggsvkdrislrmiedaerdgtlkpgdtiieptsgntgiglalaaavrg
yrciivmpekmssekvdvlralgaeivrtpteshvgvawrlkneipnshildqyrnasnp
lahydttadeilqqcdgkldmlvasvgtggtitgiarklkekcpgcriigvdpegsilae
peelnqteqttyevegigydfiptvldrtvvdkwfksndeeaftfarmliaqegllcggs
agstvavavkaaqelqegqrcvvilpdsvrnymtkflsdrwmlqkgfl

SCOPe Domain Coordinates for d1jbqd_:

Click to download the PDB-style file with coordinates for d1jbqd_.
(The format of our PDB-style files is described here.)

Timeline for d1jbqd_: