SCOPe 2.05: Domain d1jbpe_: 1jbp E:

Lineage for d1jbpe_ (1jbp E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56119] (29 PDB entries)

8. Domain d1jbpe_: 1jbp E: [62849]
   complexed with adp, oct

Details for d1jbpe_

PDB Entry: 1jbp, 2.2 Å

PDB Description: crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a substrate peptide, adp and detergent

PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1jbpe_:

Sequence; same for both SEQRES and ATOM records:

>d1jbpe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
gseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnh
yamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggem
fshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfa
krvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadepiqiye
kivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqr
kveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

Timeline for d1jbpe_:

• d1jbpe_ first appeared in SCOP 1.57
  
• d1jbpe_ appears in SCOPe 2.04
  
• d1jbpe_ appears in SCOPe 2.06
  
• d1jbpe_ appears in the current release, SCOPe 2.08