Lineage for d1jbda_ (1jbd A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89158Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 89159Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 89160Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 89173Protein Bungarotoxin [57324] (3 species)
  7. 89174Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (14 PDB entries)
  8. 89180Domain d1jbda_: 1jbd A: [62844]

Details for d1jbda_

PDB Entry: 1jbd (more details)

PDB Description: nmr structure of the complex between alpha-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor

SCOP Domain Sequences for d1jbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbda_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOP Domain Coordinates for d1jbda_:

Click to download the PDB-style file with coordinates for d1jbda_.
(The format of our PDB-style files is described here.)

Timeline for d1jbda_: