SCOPe 2.02: Domain d1jbba_: 1jbb A:

Lineage for d1jbba_ (1jbb A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (4 PDB entries)

8. Domain d1jbba_: 1jbb A: [62842]

Details for d1jbba_

PDB Entry: 1jbb, 2 Å

PDB Description: Ubiquitin Conjugating Enzyme, Ubc13

PDB Compounds: (A:) ubiquitin conjugating enzyme E2-17.5 KDA

SCOPe Domain Sequences for d1jbba_:

Sequence; same for both SEQRES and ATOM records:

>d1jbba_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
pmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpla
ndvaedwikneqgakakarewtklyakk

Timeline for d1jbba_:

• d1jbba_ first appeared in SCOP 1.57
  
• d1jbba_ appears in SCOPe 2.01
  
• d1jbba_ appears in SCOPe 2.03
  
• d1jbba_ appears in the current release, SCOPe 2.08