![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Core domain of telomere end binding protein beta subunit [50275] (1 species) |
![]() | Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries) |
![]() | Domain d1jb7b_: 1jb7 B: [62839] Other proteins in same PDB: d1jb7a1, d1jb7a2, d1jb7a3 protein/DNA complex; complexed with cl, na |
PDB Entry: 1jb7 (more details), 1.86 Å
SCOPe Domain Sequences for d1jb7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb7b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]} qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag ivkasaskgdefsdfsfkegntatlkiadifvqekg
Timeline for d1jb7b_: