Lineage for d1jb7b_ (1jb7 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374604Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 374613Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 374614Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries)
  8. 374615Domain d1jb7b_: 1jb7 B: [62839]
    Other proteins in same PDB: d1jb7a1, d1jb7a2, d1jb7a3
    complexed with cl, na

Details for d1jb7b_

PDB Entry: 1jb7 (more details), 1.86 Å

PDB Description: DNA G-Quartets in a 1.86 A Resolution Structure of an Oxytricha nova Telomeric Protein-DNA Complex

SCOP Domain Sequences for d1jb7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb7b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova}
qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
ivkasaskgdefsdfsfkegntatlkiadifvqekg

SCOP Domain Coordinates for d1jb7b_:

Click to download the PDB-style file with coordinates for d1jb7b_.
(The format of our PDB-style files is described here.)

Timeline for d1jb7b_: