Lineage for d1jb7a1 (1jb7 A:36-204)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374604Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 374710Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 374711Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)
  8. 374712Domain d1jb7a1: 1jb7 A:36-204 [62836]
    Other proteins in same PDB: d1jb7b_

Details for d1jb7a1

PDB Entry: 1jb7 (more details), 1.86 Å

PDB Description: DNA G-Quartets in a 1.86 A Resolution Structure of an Oxytricha nova Telomeric Protein-DNA Complex

SCOP Domain Sequences for d1jb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb7a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

SCOP Domain Coordinates for d1jb7a1:

Click to download the PDB-style file with coordinates for d1jb7a1.
(The format of our PDB-style files is described here.)

Timeline for d1jb7a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jb7b_