Lineage for d1jb7a1 (1jb7 A:36-204)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166823Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (7 proteins)
  6. 166871Protein Telomere end binding protein alpha subunit [50273] (1 species)
  7. 166872Species Oxytricha nova [TaxId:200597] [50274] (4 PDB entries)
  8. 166873Domain d1jb7a1: 1jb7 A:36-204 [62836]
    Other proteins in same PDB: d1jb7b_

Details for d1jb7a1

PDB Entry: 1jb7 (more details), 1.86 Å

PDB Description: DNA G-Quartets in a 1.86 A Resolution Structure of an Oxytricha nova Telomeric Protein-DNA Complex

SCOP Domain Sequences for d1jb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb7a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

SCOP Domain Coordinates for d1jb7a1:

Click to download the PDB-style file with coordinates for d1jb7a1.
(The format of our PDB-style files is described here.)

Timeline for d1jb7a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jb7b_