Lineage for d1jb0l_ (1jb0 L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633219Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 2633220Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 2633221Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 2633222Protein Photosystem I reaction center subunit XI, PsaL [81566] (1 species)
  7. 2633223Species Synechococcus elongatus [TaxId:32046] [81565] (1 PDB entry)
  8. 2633224Domain d1jb0l_: 1jb0 L: [62829]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cla, lhg, lmg, pqn, sf4

Details for d1jb0l_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
PDB Compounds: (L:) photosystem 1 reaction centre subunit xi

SCOPe Domain Sequences for d1jb0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0l_ f.31.1.1 (L:) Photosystem I reaction center subunit XI, PsaL {Synechococcus elongatus [TaxId: 32046]}
lvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpwv
klgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqftag
ffvgamgsafvaffllenflvvdgimtglfn

SCOPe Domain Coordinates for d1jb0l_:

Click to download the PDB-style file with coordinates for d1jb0l_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0l_: