Lineage for d1jb0j_ (1jb0 J:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520247Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (1 family) (S)
  5. 520248Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (1 protein)
  6. 520249Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (1 species)
  7. 520250Species Synechococcus elongatus [TaxId:32046] [81541] (1 PDB entry)
  8. 520251Domain d1jb0j_: 1jb0 J: [62827]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_

Details for d1jb0j_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0j_ f.23.18.1 (J:) Subunit IX of photosystem I reaction centre, PsaJ {Synechococcus elongatus}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl

SCOP Domain Coordinates for d1jb0j_:

Click to download the PDB-style file with coordinates for d1jb0j_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0j_: