Lineage for d1jb0e_ (1jb0 E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461565Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 461571Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein)
  6. 461572Protein Photosystem I accessory protein E (PsaE) [50095] (4 species)
  7. 461581Species Synechococcus elongatus [TaxId:32046] [63752] (1 PDB entry)
  8. 461582Domain d1jb0e_: 1jb0 E: [62824]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_

Details for d1jb0e_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0e_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechococcus elongatus}
vqrgskvkilrpesywynevgtvasvdqtpgvkypvivrfdkvnytgysgsasgvntnnf
alhevqeva

SCOP Domain Coordinates for d1jb0e_:

Click to download the PDB-style file with coordinates for d1jb0e_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0e_: