SCOP 1.57: Domain d1jb0e_: 1jb0 E:

Lineage for d1jb0e_ (1jb0 E:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families)

5. Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein)

6. Protein Photosystem I accessory protein E (PsaE) [50095] (3 species)

7. Species Synechococcus elongatus [TaxId:32046] [63752] (1 PDB entry)

8. Domain d1jb0e_: 1jb0 E: [62824]
   Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_

Details for d1jb0e_

PDB Entry: 1jb0, 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0e_:

Sequence; same for both SEQRES and ATOM records:

>d1jb0e_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechococcus elongatus}
vqrgskvkilrpesywynevgtvasvdqtpgvkypvivrfdkvnytgysgsasgvntnnf
alhevqeva

Timeline for d1jb0e_:

• d1jb0e_ is new in SCOP 1.57
  
• d1jb0e_ appears in SCOP 1.59
  
• d1jb0e_ appears in the current release, SCOPe 2.08