Lineage for d1jb0a_ (1jb0 A:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268510Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 268511Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (1 family) (S)
  5. 268512Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (2 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 268513Protein Apoprotein a1, PsaA [81554] (1 species)
  7. 268514Species Synechococcus elongatus [TaxId:32046] [81553] (1 PDB entry)
  8. 268515Domain d1jb0a_: 1jb0 A: [62820]
    Other proteins in same PDB: d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0a_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0a_:

Sequence, based on SEQRES records: (download)

>d1jb0a_ f.29.1.1 (A:) Apoprotein a1, PsaA {Synechococcus elongatus}
rvvvdndpvptsfekwakpghfdrtlargpqtttwiwnlhalahdfdthtsdledisrki
fsahfghlavvfiwlsgmyfhgakfsnyeawladptgikpsaqvvwpivgqgilngdvgg
gfhgiqitsglfqlwrasgitnefqlyctaigglvmaglmlfagwfhyhkrapklewfqn
vesmlnhhlagllglgslawaghqihvslpinklldagvaakdiplphefilnpslmael
ypkvdwgffsgvipfftfnwaaysdfltfngglnpvtgglwlsdtahhhlaiavlfiiag
hmyrtnwgighslkeileahkgpftgaghkglyevlttswhaqlainlammgslsiivaq
hmyamppypylatdyptqlslfthhmwiggflvvggaahgaifmvrdydpamnqnnvldr
vlrhrdaiishlnwvciflgfhsfglyvhndtmrafgrpqdmfsdtgiqlqpvfaqwvqn
lhtlapggtapnaaatasvafggdvvavggkvammpivlgtadfmvhhihaftihvtvli
llkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyncisvvifh
fswkmqsdvwgtvapdgtvshitggnfaqsaitingwlrdflwaqasqvigsygsalsay
gllflgahfiwafslmflfsgrgywqeliesivwahnklkvapaiqpralsiiqgravgv
ahyllggiattwafflariisvg

Sequence, based on observed residues (ATOM records): (download)

>d1jb0a_ f.29.1.1 (A:) Apoprotein a1, PsaA {Synechococcus elongatus}
rvvvdndpvptsfekwakpghfdrtlargpqtttwiwnlhalahdfdthtsdledisrki
fsahfghlavvfiwlsgmyfhgakfsnyeawladptgikpsaqvvwpivgqgilngdvgg
gfhgiqitsglfqlwrasgitnefqlyctaigglvmaglmlfagwfhyhkrapklewfqn
vesmlnhhlagllglgslawaghqihvslpinklldagvaakdiplphefilnpslmael
ypkvdwgffspfftfnwaaysdfltfngglnpvtgglwlsdtahhhlaiavlfiiaghmy
rtnwgighslkeileahkgpftgaghkglyevlttswhaqlainlammgslsiivaqhmy
amppypylatdyptqlslfthhmwiggflvvggaahgaifmvrdydpamnqnnvldrvlr
hrdaiishlnwvciflgfhsfglyvhndtmrafgrpqdmfsdtgiqlqpvfaqwvqnlht
lapggtapnaaatasvafggdvvavggkvammpivlgtadfmvhhihaftihvtvlillk
gvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyncisvvifhfsw
kmqsdvwgtvapdgtvshitggnfaqsaitingwlrdflwaqasqvigsygsalsaygll
flgahfiwafslmflfsgrgywqeliesivwahnklkvapaiqpralsiiqgravgvahy
llggiattwafflariisvg

SCOP Domain Coordinates for d1jb0a_:

Click to download the PDB-style file with coordinates for d1jb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0a_: