Lineage for d1jatb_ (1jat B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78902Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)
  4. 78903Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) (S)
  5. 78904Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)
  6. 78905Protein Ubiquitin conjugating enzyme [54497] (12 species)
  7. 78908Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (1 PDB entry)
  8. 78909Domain d1jatb_: 1jat B: [62819]

Details for d1jatb_

PDB Entry: 1jat (more details), 1.6 Å

PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1jatb_:

Sequence, based on SEQRES records: (download)

>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), mms2}
skvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysls
idcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkema
tpankklrqpkegetf

Sequence, based on observed residues (ATOM records): (download)

>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), mms2}
skvprnfrlleelekgekescsygladsdditmtkwngtilgpphsnhenriyslsidcg
pnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkematpan
kklrqpkegetf

SCOP Domain Coordinates for d1jatb_:

Click to download the PDB-style file with coordinates for d1jatb_.
(The format of our PDB-style files is described here.)

Timeline for d1jatb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jata_