Lineage for d1jata_ (1jat A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642832Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (4 PDB entries)
  8. 1642833Domain d1jata_: 1jat A: [62818]
    complexed with Mms2

Details for d1jata_

PDB Entry: 1jat (more details), 1.6 Å

PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
PDB Compounds: (A:) Ubiquitin-Conjugating Enzyme E2-17.5 KDA

SCOPe Domain Sequences for d1jata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
aaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
landvaedwikneqgakakarewtklyakkkp

SCOPe Domain Coordinates for d1jata_:

Click to download the PDB-style file with coordinates for d1jata_.
(The format of our PDB-style files is described here.)

Timeline for d1jata_: