![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (4 PDB entries) |
![]() | Domain d1jata_: 1jat A: [62818] complexed with Mms2 |
PDB Entry: 1jat (more details), 1.6 Å
SCOPe Domain Sequences for d1jata_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} aaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp landvaedwikneqgakakarewtklyakkkp
Timeline for d1jata_: