Lineage for d1jata_ (1jat A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (12 species) Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (2 PDB entries) 
Domain d1jata_: 1jat A: [62818]
Details for d1jata_
PDB Entry: 1jat (more details), 1.6 Å
PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
SCOP Domain Sequences for d1jata_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc13}
aaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
landvaedwikneqgakakarewtklyakkkp
SCOP Domain Coordinates for d1jata_:
Click to download the PDB-style file with coordinates for d1jata_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jata_:
- d1jata_ is new in SCOP 1.57
- d1jata_ appears in SCOP 1.59
- d1jata_ appears in the current release, SCOPe 2.08, called d1jata1
View in 3D
