Lineage for d1jata_ (1jat A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78902Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)
  4. 78903Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) (S)
  5. 78904Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)
  6. 78905Protein Ubiquitin conjugating enzyme [54497] (12 species)
  7. 78910Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (2 PDB entries)
  8. 78911Domain d1jata_: 1jat A: [62818]

Details for d1jata_

PDB Entry: 1jat (more details), 1.6 Å

PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1jata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc13}
aaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
landvaedwikneqgakakarewtklyakkkp

SCOP Domain Coordinates for d1jata_:

Click to download the PDB-style file with coordinates for d1jata_.
(The format of our PDB-style files is described here.)

Timeline for d1jata_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jatb_