Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries) |
Domain d1jata1: 1jat A:2-152 [62818] Other proteins in same PDB: d1jata2 complexed with Mms2 |
PDB Entry: 1jat (more details), 1.6 Å
SCOPe Domain Sequences for d1jata1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jata1 d.20.1.1 (A:2-152) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} aslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpdd ypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpl andvaedwikneqgakakarewtklyakkkp
Timeline for d1jata1: