Lineage for d1jata1 (1jat A:2-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939002Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries)
  8. 2939003Domain d1jata1: 1jat A:2-152 [62818]
    Other proteins in same PDB: d1jata2
    complexed with Mms2

Details for d1jata1

PDB Entry: 1jat (more details), 1.6 Å

PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
PDB Compounds: (A:) Ubiquitin-Conjugating Enzyme E2-17.5 KDA

SCOPe Domain Sequences for d1jata1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jata1 d.20.1.1 (A:2-152) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
aslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpdd
ypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpl
andvaedwikneqgakakarewtklyakkkp

SCOPe Domain Coordinates for d1jata1:

Click to download the PDB-style file with coordinates for d1jata1.
(The format of our PDB-style files is described here.)

Timeline for d1jata1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jata2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jatb_