| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries) |
| Domain d1ja8b2: 1ja8 B:84-198 [62816] Other proteins in same PDB: d1ja8a1, d1ja8b1 |
PDB Entry: 1ja8 (more details), 2.12 Å
SCOP Domain Sequences for d1ja8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ja8b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvaehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d1ja8b2: