Lineage for d1ja8b2 (1ja8 B:84-198)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328095Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 328096Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 328097Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 328176Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 328220Species Human (Homo sapiens) [TaxId:9606] [54724] (11 PDB entries)
  8. 328234Domain d1ja8b2: 1ja8 B:84-198 [62816]
    Other proteins in same PDB: d1ja8a1, d1ja8b1
    complexed with mn, so4; mutant

Details for d1ja8b2

PDB Entry: 1ja8 (more details), 2.12 Å

PDB Description: kinetic analysis of product inhibition in human manganese superoxide dismutase

SCOP Domain Sequences for d1ja8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja8b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvaehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1ja8b2:

Click to download the PDB-style file with coordinates for d1ja8b2.
(The format of our PDB-style files is described here.)

Timeline for d1ja8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ja8b1