Lineage for d1ja8b1 (1ja8 B:1-83)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 532116Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 532117Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 532233Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 532282Species Human (Homo sapiens) [TaxId:9606] [46619] (14 PDB entries)
  8. 532302Domain d1ja8b1: 1ja8 B:1-83 [62815]
    Other proteins in same PDB: d1ja8a2, d1ja8b2
    complexed with mn, so4; mutant

Details for d1ja8b1

PDB Entry: 1ja8 (more details), 2.12 Å

PDB Description: kinetic analysis of product inhibition in human manganese superoxide dismutase

SCOP Domain Sequences for d1ja8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja8b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1ja8b1:

Click to download the PDB-style file with coordinates for d1ja8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ja8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ja8b2