SCOP 1.57: Domain d1ja1b1: 1ja1 B:240-518

Lineage for d1ja1b1 (1ja1 B:240-518)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (2 proteins)

6. Protein NADPH-cytochrome p450 reductase [50439] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50440] (4 PDB entries)

8. Domain d1ja1b1: 1ja1 B:240-518 [62806]
   Other proteins in same PDB: d1ja1a2, d1ja1a3, d1ja1b2, d1ja1b3

Details for d1ja1b1

PDB Entry: 1ja1, 1.8 Å

PDB Description: cypor-triple mutant

SCOP Domain Sequences for d1ja1b1:

Sequence; same for both SEQRES and ATOM records:

>d1ja1b1 b.43.4.1 (B:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus)}
ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh
pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw
vvearrhilailqdypslrppidhlcellprlqaryyaiassskvhpnsvhicavaveye
aksgrvnkgvatswlrakepagenggralvpmfvrksqf

Timeline for d1ja1b1:

• d1ja1b1 is new in SCOP 1.57
  
• d1ja1b1 appears in SCOP 1.59
  
• d1ja1b1 appears in the current release, SCOPe 2.08