Lineage for d1ja1a1 (1ja1 A:240-518)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167645Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 167646Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (3 proteins)
  6. 167647Protein NADPH-cytochrome p450 reductase [50439] (1 species)
  7. 167648Species Rat (Rattus norvegicus) [TaxId:10116] [50440] (4 PDB entries)
  8. 167649Domain d1ja1a1: 1ja1 A:240-518 [62803]
    Other proteins in same PDB: d1ja1a2, d1ja1a3, d1ja1b2, d1ja1b3

Details for d1ja1a1

PDB Entry: 1ja1 (more details), 1.8 Å

PDB Description: cypor-triple mutant

SCOP Domain Sequences for d1ja1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus)}
ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh
pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw
vvearrhilailqdypslrppidhlcellprlqaryyaiassskvhpnsvhicavaveye
aksgrvnkgvatswlrakepagenggralvpmfvrksqf

SCOP Domain Coordinates for d1ja1a1:

Click to download the PDB-style file with coordinates for d1ja1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ja1a1: