Lineage for d1ja0b2 (1ja0 B:519-676)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859873Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins)
  6. 2859874Protein NADPH-cytochrome p450 reductase [52366] (1 species)
  7. 2859875Species Norway rat (Rattus norvegicus) [TaxId:10116] [52367] (4 PDB entries)
  8. 2859883Domain d1ja0b2: 1ja0 B:519-676 [62802]
    Other proteins in same PDB: d1ja0a1, d1ja0a2, d1ja0b1
    complexed with fad, fmn, nap

Details for d1ja0b2

PDB Entry: 1ja0 (more details), 2.6 Å

PDB Description: cypor-w677x
PDB Compounds: (B:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1ja0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja0b2 c.25.1.4 (B:519-676) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgrysldv

SCOPe Domain Coordinates for d1ja0b2:

Click to download the PDB-style file with coordinates for d1ja0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ja0b2: