Lineage for d1ja0b1 (1ja0 B:242-518)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054656Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 protein domains)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2054657Protein NADPH-cytochrome p450 reductase [50439] (1 species)
  7. 2054658Species Norway rat (Rattus norvegicus) [TaxId:10116] [50440] (4 PDB entries)
  8. 2054666Domain d1ja0b1: 1ja0 B:242-518 [62801]
    Other proteins in same PDB: d1ja0a2, d1ja0a3, d1ja0b2
    complexed with fad, fmn, nap

Details for d1ja0b1

PDB Entry: 1ja0 (more details), 2.6 Å

PDB Description: cypor-w677x
PDB Compounds: (B:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1ja0b1:

Sequence, based on SEQRES records: (download)

>d1ja0b1 b.43.4.1 (B:242-518) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
irqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlm
hleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpf
pcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvv
earrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeak
sgrvnkgvatswlrakepagenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d1ja0b1 b.43.4.1 (B:242-518) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
irqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlm
hleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpf
pcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvv
earrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeak
sgrvnkgvatswlrakepaggralvpmfvrksqf

SCOPe Domain Coordinates for d1ja0b1:

Click to download the PDB-style file with coordinates for d1ja0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ja0b1: