Lineage for d1j9zb3 (1j9z B:519-678)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468137Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins)
  6. 2468138Protein NADPH-cytochrome p450 reductase [52366] (1 species)
  7. 2468139Species Norway rat (Rattus norvegicus) [TaxId:10116] [52367] (4 PDB entries)
  8. 2468145Domain d1j9zb3: 1j9z B:519-678 [62797]
    Other proteins in same PDB: d1j9za1, d1j9za2, d1j9zb1, d1j9zb2
    complexed with fad, fmn, nap

Details for d1j9zb3

PDB Entry: 1j9z (more details), 2.7 Å

PDB Description: cypor-w677g
PDB Compounds: (B:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1j9zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9zb3 c.25.1.4 (B:519-678) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgrysldvgs

SCOPe Domain Coordinates for d1j9zb3:

Click to download the PDB-style file with coordinates for d1j9zb3.
(The format of our PDB-style files is described here.)

Timeline for d1j9zb3: