Lineage for d1j9zb2 (1j9z B:64-239)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68298Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 68375Family c.23.5.2: NADPH-cytochrome p450 reductase, N-terminal domain [52231] (1 protein)
  6. 68376Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species)
  7. 68379Species Rat (Rattus norvegicus) [TaxId:10116] [52233] (4 PDB entries)
  8. 68385Domain d1j9zb2: 1j9z B:64-239 [62796]
    Other proteins in same PDB: d1j9za1, d1j9za3, d1j9zb1, d1j9zb3

Details for d1j9zb2

PDB Entry: 1j9z (more details), 2.7 Å

PDB Description: cypor-w677g

SCOP Domain Sequences for d1j9zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9zb2 c.23.5.2 (B:64-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus)}
vkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladls
slpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfna
mgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee

SCOP Domain Coordinates for d1j9zb2:

Click to download the PDB-style file with coordinates for d1j9zb2.
(The format of our PDB-style files is described here.)

Timeline for d1j9zb2: