Lineage for d1j9ya_ (1j9y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082627Protein Mannanase A, ManA [63908] (2 species)
  7. 2082632Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [63909] (5 PDB entries)
  8. 2082638Domain d1j9ya_: 1j9y A: [62791]
    complexed with zn

Details for d1j9ya_

PDB Entry: 1j9y (more details), 1.85 Å

PDB Description: crystal structure of mannanase 26a from pseudomonas cellulosa
PDB Compounds: (A:) mannanase a

SCOPe Domain Sequences for d1j9ya_:

Sequence, based on SEQRES records: (download)

>d1j9ya_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
pvtvklvdsqatmetrslfafmqeqrrhsimfghqhettqgltitrtdgtqsdtfnavgd
faavygwdtlsivapkaegdivaqvkkayarggiitvsshfdnpktdtqkgvwpvgtswd
qtpavvdslpggaynpvlngyldqvaewannlkdeqgrlipvifrlyhentgswfwwgdk
qstpeqykqlfrysveylrdvkgvrnflyayspnnfwdvteanylerypgdewvdvlgfd
tygpvadnadwfrnvvanaalvarmaeargkipviseigirapdieaglydnqwyrklis
glkadpdareiafllvwrnapqgvpgpngtqvphywvpanrpeninngtledfqafyade
ftafnrdieqvyqrpt

Sequence, based on observed residues (ATOM records): (download)

>d1j9ya_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
pvtvklvdsqatmetrslfafmqeqrrhsimfghqhettqgltitrtdgtqsdtfnavgd
faavygwdtlsivapkaegdivaqvkkayarggiitvsshfdnpktdtqkgvwpvgtswd
qtpavvdslpggaynpvlngyldqvaewannlkdeqgrlipvifrlyhentgswfwwgdk
qstpeqykqlfrysveylrdvkgvrnflyayspnnfwdvteanylerypgdewvdvlgfd
tygpvadnadwfrnvvanaalvarmaeargkipviseigilydnqwyrklisglkadpda
reiafllvwtledfqafyadeftafnrdieqvyqrpt

SCOPe Domain Coordinates for d1j9ya_:

Click to download the PDB-style file with coordinates for d1j9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1j9ya_: