Lineage for d1j9wb_ (1j9w B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2420921Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)
  8. 2420950Domain d1j9wb_: 1j9w B: [62790]
    complexed with edo, zn

Details for d1j9wb_

PDB Entry: 1j9w (more details), 2.6 Å

PDB Description: solution structure of the cai michigan 1 variant
PDB Compounds: (B:) carbonic anhydrase I

SCOPe Domain Sequences for d1j9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9wb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOPe Domain Coordinates for d1j9wb_:

Click to download the PDB-style file with coordinates for d1j9wb_.
(The format of our PDB-style files is described here.)

Timeline for d1j9wb_: