Lineage for d1j9wb_ (1j9w B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63199Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 63200Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 63201Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 63202Protein Carbonic anhydrase [51071] (9 species)
  7. 63205Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries)
  8. 63216Domain d1j9wb_: 1j9w B: [62790]

Details for d1j9wb_

PDB Entry: 1j9w (more details), 2.6 Å

PDB Description: solution structure of the cai michigan 1 variant

SCOP Domain Sequences for d1j9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9wb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOP Domain Coordinates for d1j9wb_:

Click to download the PDB-style file with coordinates for d1j9wb_.
(The format of our PDB-style files is described here.)

Timeline for d1j9wb_: