Lineage for d1j9wa_ (1j9w A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) 
Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries) 
Domain d1j9wa_: 1j9w A: [62789]
Details for d1j9wa_
PDB Entry: 1j9w (more details), 2.6 Å
PDB Description: solution structure of the cai michigan 1 variant
SCOP Domain Sequences for d1j9wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9wa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf
SCOP Domain Coordinates for d1j9wa_:
Click to download the PDB-style file with coordinates for d1j9wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j9wa_:
- d1j9wa_ first appeared in SCOP 1.57
- d1j9wa_ appears in SCOP 1.59
- d1j9wa_ appears in SCOP 1.63
- d1j9wa_ appears in the current release, SCOPe 2.08
View in 3D
