| Class b: All beta proteins [48724] (178 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries) Uniprot P38501 |
| Domain d1j9sc2: 1j9s C:167-339 [62782] complexed with cu, no2 |
PDB Entry: 1j9s (more details), 1.9 Å
SCOPe Domain Sequences for d1j9sc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9sc2 b.6.1.3 (C:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrpnligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1j9sc2:
View in 3DDomains from other chains: (mouse over for more information) d1j9sa1, d1j9sa2, d1j9sb1, d1j9sb2 |