Lineage for d1j9sc1 (1j9s C:4-166)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56231Protein Nitrite reductase, NIR [49551] (3 species)
  7. 56255Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (13 PDB entries)
  8. 56270Domain d1j9sc1: 1j9s C:4-166 [62781]

Details for d1j9sc1

PDB Entry: 1j9s (more details), 1.9 Å

PDB Description: crystal structure of nitrite soaked oxidized h255n afnir

SCOP Domain Sequences for d1j9sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9sc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOP Domain Coordinates for d1j9sc1:

Click to download the PDB-style file with coordinates for d1j9sc1.
(The format of our PDB-style files is described here.)

Timeline for d1j9sc1: