SCOP 1.57: Domain d1j9sa2: 1j9s A:167-339

Lineage for d1j9sa2 (1j9s A:167-339)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)

6. Protein Nitrite reductase, NIR [49551] (3 species)

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (13 PDB entries)

8. Domain d1j9sa2: 1j9s A:167-339 [62778]

Details for d1j9sa2

PDB Entry: 1j9s, 1.9 Å

PDB Description: crystal structure of nitrite soaked oxidized h255n afnir

SCOP Domain Sequences for d1j9sa2:

Sequence; same for both SEQRES and ATOM records:

>d1j9sa2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrpnligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1j9sa2:

• d1j9sa2 is new in SCOP 1.57
  
• d1j9sa2 appears in SCOP 1.59
  
• d1j9sa2 appears in the current release, SCOPe 2.08