Lineage for d1j9rb2 (1j9r B:167-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381404Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
    Uniprot P38501
  8. 2381558Domain d1j9rb2: 1j9r B:167-339 [62774]
    complexed with cu, no2

Details for d1j9rb2

PDB Entry: 1j9r (more details), 2 Å

PDB Description: crystal structure of nitrite soaked reduced d98n afnir
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1j9rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9rb2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOPe Domain Coordinates for d1j9rb2:

Click to download the PDB-style file with coordinates for d1j9rb2.
(The format of our PDB-style files is described here.)

Timeline for d1j9rb2: