Class b: All beta proteins [48724] (144 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (6 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries) |
Domain d1j9qb2: 1j9q B:167-339 [62768] |
PDB Entry: 1j9q (more details), 1.65 Å
SCOP Domain Sequences for d1j9qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9qb2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1j9qb2:
View in 3D Domains from other chains: (mouse over for more information) d1j9qa1, d1j9qa2, d1j9qc1, d1j9qc2 |