Lineage for d1j9kb_ (1j9k B:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.106: SurE-like [64166] (1 superfamily) Superfamily c.106.1: SurE-like [64167] (1 family) 
Family c.106.1.1: SurE-like [64168] (1 protein) Protein SurE homolog TM1662 [64169] (1 species) Species Thermotoga maritima [TaxId:243274] [64170] (3 PDB entries) 
Domain d1j9kb_: 1j9k B: [62761]
Details for d1j9kb_
PDB Entry: 1j9k (more details), 2.1 Å
PDB Description: crystal structure of sure protein from t.maritima in complex with tungstate
SCOP Domain Sequences for d1j9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9kb_ c.106.1.1 (B:) SurE homolog TM1662 {Thermotoga maritima}
mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfise
rvvaysttgtpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammn
ipsiaissanyespdfegaarflidflkefdfslldpftmlninvpageikgwrftrqsr
rrwndyfeervspfgekyywmmgeviedddrddvdykavregyvsitpihpfltneqclk
klrevyd
SCOP Domain Coordinates for d1j9kb_:
Click to download the PDB-style file with coordinates for d1j9kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j9kb_:
- d1j9kb_ is new in SCOP 1.57
- d1j9kb_ appears in SCOP 1.59
- d1j9kb_ appears in the current release, SCOPe 2.08
View in 3D
