SCOPe 2.08: Domain d1j9ka_: 1j9k A:

Lineage for d1j9ka_ (1j9k A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.1: SurE-like [64168] (2 proteins)

6. Protein SurE homolog TM1662 [64169] (1 species)
   has a phosphatase activity

7. Species Thermotoga maritima [TaxId:2336] [64170] (4 PDB entries)

8. Domain d1j9ka_: 1j9k A: [62760]
   complexed with tungstate
   complexed with ca, epe, wo4

Details for d1j9ka_

PDB Entry: 1j9k, 2.1 Å

PDB Description: crystal structure of sure protein from t.maritima in complex with tungstate

PDB Compounds: (A:) stationary phase survival protein

SCOPe Domain Sequences for d1j9ka_:

Sequence; same for both SEQRES and ATOM records:

>d1j9ka_ c.106.1.1 (A:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]}
mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfise
rvvaysttgtpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammn
ipsiaissanyespdfegaarflidflkefdfslldpftmlninvpageikgwrftrqsr
rrwndyfeervspfgekyywmmgeviedddrddvdykavregyvsitpihpfltneqclk
klrevyd

Timeline for d1j9ka_:

• d1j9ka_ first appeared in SCOP 1.57
  
• d1j9ka_ appears in SCOPe 2.07